Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Adrenomedullin 5 (primate) trifluoroacetate salt
H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂ trifluoroacetate salt
(Disulfide bond)

H-6612

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6612.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 630.00
CHF 585.90 (7%)
H-6612.1000 1 mg Ships within 3-5 business days  
CHF 1,156.00
CHF 1,075.08 (7%)
Add to Wish List
Add to Compare

Details

Adrenomedullin 5 (AM5) stimulates central and peripheral cardiovascular actions in mammals. The peptide induced dose-dependent decreases in arterial pressure without affecting the heart rate, when injected intravenously. When injected into the cerebral ventricle, ADM5 increased arterial pressure and heart rate.
Item Number 4062220
One Letter Code HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂
Synonyms AM5 (primate)
Molecular Formula C₂₅₃H₃₉₄N₈₂O₇₁S₂
Relative Molecular Mass 5784.55
CAS Registry Number [1816939-48-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone