Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Preptin (rat) trifluoroacetate salt
H-Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu-OH trifluoroacetate salt

H-6572

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6572.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 105.00
CHF 97.65 (7%)
H-6572.0500 0.5 mg Ships within 3-5 business days  
CHF 420.00
CHF 390.60 (7%)
H-6572.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 788.00
CHF 732.84 (7%)
Add to Wish List
Add to Compare

Details

Preptin is a 34-amino acid peptide hormone, which is co-secreted with insulin from the pancreatic β-cells in response to glucose stimulation. It is osteogenic in vitro and in vivo and may act in concert with the other β-cell hormones insulin and amylin to stimulate bone formation in hyperinsulinemic states such as obesity.
Item Number 4050843
One Letter Code DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
Molecular Formula C₁₈₁H₂₆₈N₄₈O₅₁
Relative Molecular Mass 3932.41
CAS Registry Number [315197-73-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes
Regenerative Medicine