Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Preptin (human) trifluoroacetate salt
H-Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH trifluoroacetate salt

H-6568

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6568.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-6568.0005 5 mg Ships within 3-5 business days  
CHF 1'030.00
CHF 957.90 (7%)
Add to Wish List
Add to Compare

Details

Preptin is a 34-amino acid peptide hormone, corresponding to Asp⁶⁹-Leu¹⁰² of the proinsulin-like growth factor II E-peptide. It is co-secreted with insulin and amylin from the pancreatic β-cells and is a physiological amplifier of glucose-mediated insulin secretion. It is also anabolic to bone tissue and may contribute to the preservation of bone mass observed in hyperinsulinemic states such as obesity.
Item Number 4059088
APC Number 50-1-41
One Letter Code DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Molecular Formula C₁₈₇H₂₇₅N₄₇O₅₃
Relative Molecular Mass 4029.53
CAS Registry Number [315197-69-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C