Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Glu¹³·¹⁷·²⁰)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
H-Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile-OH trifluoroacetate salt
(Disulfide bond)

H-6552

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6552.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 402.00
CHF 373.86 (7%)
H-6552.1000 1 mg Ships within 3-5 business days  
CHF 721.00
CHF 670.53 (7%)
Add to Wish List
Add to Compare

Details

Non-carboxylated osteocalcin was shown to be a bone-specific hormone involved in the regulation of glucose metabolism, for which the Gla peptide acts as precursor and transport form.
Item Number 4057685
One Letter Code YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Molecular Formula C₂₂₆H₃₅₁N₅₇O₇₄S₂
Relative Molecular Mass 5114.75
CAS Registry Number [1802086-27-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C