Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Met-RANTES (human) trifluoroacetate salt
H-Met-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser-OH trifluoroacetate salt
(Disulfide bonds between Cys¹¹ and Cys³⁵/Cys¹² and Cys⁵¹)

H-6544

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6544.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-6544.1000 1 mg Request lead time  
CHF 3'399.00
CHF 3'161.07 (7%)
Add to Wish List
Add to Compare

Details

Synthetic product. Potent antagonist of RANTES and macrophage inflammatory polypeptide-1α (MIP-1α). Met-RANTES inhibited RANTES- or MIP-1α-induced chemotaxis of promonocytic THP-1cells and T-cells. Although Met-RANTES antagonized RANTES and MIP-1α with similar potency in the chemotaxis response it showed a clear difference in the cytokine-induced calcium mobilization assay.
Item Number 4058353
One Letter Code MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Molecular Formula C₃₅₅H₅₄₃N₉₇O₁₀₁S₆
Relative Molecular Mass 7978.21
CAS Registry Number [1883816-50-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C