Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

CRAMP (mouse) trifluoroacetate salt
H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH trifluoroacetate salt

H-6526

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6526.0001 1 mg Ships within 3-5 business days  
CHF 206.00
CHF 191.58 (7%)
H-6526.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 824.00
CHF 766.32 (7%)
Add to Wish List
Add to Compare

Details

CRAMP is a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse. Functional studies showed CRAMP to be a potent antibiotic against Gram-negative bacteria by inhibiting growth of a variety of bacterial strains and by permeabilizing the inner membrane of E.coli directly.
Item Number 4056438
One Letter Code GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Molecular Formula C₁₇₈H₃₀₂N₅₀O₄₆
Relative Molecular Mass 3878.67
CAS Registry Number [376364-36-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Murine antimicrobial peptide