Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Kisspeptin-54 (human) trifluoroacetate salt
H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ trifluoroacetate salt

H-6514

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6514.0500 0.5 mg Ships within 3-5 business days  
CHF 618.00
CHF 574.74 (7%)
H-6514.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'133.00
CHF 1'053.69 (7%)
Add to Wish List
Add to Compare

Details

Kisspeptin-54, an endogenous ligand of the G protein-coupled receptor GPR54, is a key regulator of the hypothalamo-pituitary-gonadal (HPG) axis. It stimulates LH and FSH secretion. Kisspeptin-54 may represent a versatile tool for the manipulation of the HPG axis.
Item Number 4054937
One Letter Code GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂
Synonyms Metastin (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (68-121) (human), KiSS-1 (68-121) (human)
Molecular Formula C₂₅₈H₄₀₁N₇₉O₇₈
Relative Molecular Mass 5857.51
CAS Registry Number [374683-24-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C