Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Nesfatin-1 (mouse) trifluoroacetate salt
H-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Thr-Glu-Pro-Val-Glu-Asn-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val-Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu-OH trifluoroacetate salt

H-6474

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6474.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-6474.0250 250 µg Ships within 3-5 business days  
CHF 1'648.00
CHF 1'532.64 (7%)
Add to Wish List
Add to Compare
Item Number 4054142
One Letter Code VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms Nucleobindin-2 (25-106) (mouse), NUCB2 (25-106) (mouse), DNA-Binding Protein NEFA (25-106) (mouse)
Molecular Formula C₄₂₄H₆₈₃N₁₁₇O₁₃₇
Relative Molecular Mass 9611.79
CAS Registry Number [917528-36-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Anorexigenic peptide