Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gln⁹)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-6434

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6434.0500 0.5 mg Ships within 3-5 business days  
CHF 77.00
CHF 71.61 (7%)
H-6434.1000 1 mg Ships within 3-5 business days  
CHF 129.00
CHF 119.97 (7%)
Add to Wish List
Add to Compare
Item Number 4050901
One Letter Code DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) G9Q
Molecular Formula C₁₉₇H₃₀₀N₅₄O₅₉S
Relative Molecular Mass 4400.94
CAS Registry Number [1802084-59-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease