Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Arg³)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Arg-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-6432

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6432.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 153.00
CHF 142.29 (7%)
H-6432.1000 1 mg Ships within 3-5 business days  
CHF 257.00
CHF 239.01 (7%)
Add to Wish List
Add to Compare
Item Number 4050900
One Letter Code DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) E3R
Molecular Formula C₁₉₅H₃₀₀N₅₆O₅₆S
Relative Molecular Mass 4356.94
CAS Registry Number [1802084-01-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease