Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-46)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-OH

H-6406

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6406.0500 0.5 mg Ships within 3-5 business days  
CHF 309.00
CHF 287.37 (7%)
H-6406.1000 1 mg Ships within 3-5 business days  
CHF 515.00
CHF 478.95 (7%)
Add to Wish List
Add to Compare

Details

Precursor of the secreted amyloid β-protein (1-40) and (1-42). The identification of amyloid-β-protein (1-46) led to the identification of a zeta-cleavage site between the known γ- and ε-cleavage sites within the transmembrane domain of amyloid-β precursor protein (APP).
Item Number 4050409
APC Number 62-0-59
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV
Synonyms β-Amyloid (1-46)
Molecular Formula C₂₂₃H₃₄₇N₅₉O₆₅S
Relative Molecular Mass 4926.63
CAS Registry Number [285554-31-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease