Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

SDF-1β (human) trifluoroacetate salt
H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Arg-Phe-Lys-Met-OH trifluoroacetate salt
(Disulfide bonds between Cys⁹ and Cys³⁴/Cys¹¹ and Cys⁵⁰)

H-6392

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6392.0010 10 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 185.00
CHF 172.05 (7%)
H-6392.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 742.00
CHF 690.06 (7%)
Add to Wish List
Add to Compare

Details

Synthetically produced, contains BSA (low levels of endotoxins) in a ratio of 1:50.
CXC chemokine that signals through the CXCR4 receptor and plays critical roles in migration, proliferation and differentiation of leukocytes. Since SDF-1 is involved in several problematic diseases such as AIDS, cancer cell metastasis, leukemia cell progression, rheumatoid arthritis and pulmonary fibrosis CXCR4 represents a therapeutic target for these conditions.
Item Number 4051448
One Letter Code KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Synonyms Stromal Cell-Derived Factor-1β (human)
Molecular Formula C₃₈₂H₆₂₀N₁₁₄O₉₇S₅
Relative Molecular Mass 8522.17
CAS Registry Number [1927911-05-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C