Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-6388

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6388.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 233.00
CHF 216.69 (7%)
H-6388.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 413.00
CHF 384.09 (7%)
Add to Wish List
Add to Compare
Item Number 4037472
One Letter Code CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms (Cys⁶⁶⁸,Gly⁶⁶⁹,Arg⁶⁷¹)-Amyloid β/A4 Protein Precursor₇₇₀ (668-713), (Cys⁶⁶⁸,Gly⁶⁶⁹,Arg⁶⁷¹)-APP₇₇₀ (668-713)
Molecular Formula C₂₂₀H₃₄₃N₆₃O₆₄S₂
Relative Molecular Mass 4958.66
CAS Registry Number [1802086-21-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease