Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gly²⁸,Cys³⁰)-Amyloid β-Protein (1-30) amide trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH₂ trifluoroacetate salt

H-6386

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6386.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 103.00
CHF 95.79 (7%)
H-6386.1000 1 mg Ships within 3-5 business days  
CHF 181.00
CHF 168.33 (7%)
Add to Wish List
Add to Compare
Item Number 4037473
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH₂
Synonyms (Gly⁶⁹⁹,Cys⁷⁰¹)-APP₇₇₀ (672-701) amide, Amyloid β-Protein (1-30) amide K28G/A30C, (Gly⁶⁹⁹,Cys⁷⁰¹)-Amyloid β/A4 Protein Precursor₇₇₀ (672-701) amide
Molecular Formula C₁₄₆H₂₀₉N₄₃O₄₇S
Relative Molecular Mass 3350.59
CAS Registry Number [1802080-88-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease