Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

C5a Anaphylatoxin (human) trifluoroacetate salt
H-Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg-OH trifluoroacetate salt
(Disulfide bonds between Cys²¹ and Cys⁴⁷/Cys²² and Cys⁵⁴/Cys³⁴ and Cys⁵⁵)

H-6322

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6322.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 500.00
CHF 465.00 (7%)
H-6322.0500 0.5 mg Ships within 3-5 business days  
CHF 2'000.00
CHF 1'860.00 (7%)
Add to Wish List
Add to Compare

Details

Complement 5a plays a central role in host defenses and is implicated in functions associated with sepsis, adult respiratory distress syndrome, rheumatoid arthritis, psoriasis, neurodegeneration, and ischaemia/reperfusion injury. The molecule has potent chemoattractant and pro-inflammatory properties.
Item Number 4050444
One Letter Code TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Molecular Formula C₃₅₀H₅₇₈N₁₀₈O₁₀₇S₈
Relative Molecular Mass 8267.63
CAS Registry Number [1816940-05-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Pro-inflammatory peptide
Areas of Interest Inflammation Research