Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Urocortin II (mouse) trifluoroacetate salt
H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH₂ trifluoroacetate salt

H-6238

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6238.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-6238.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 659.00
CHF 612.87 (7%)
Add to Wish List
Add to Compare

Details

Urocortin II (mouse) exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for CRF-R1. The potencies of Ucn II (mouse) in activating CRF-R2α and CRF-R2β were nearly equivalent to that of urocortin (rat).
Item Number 4048157
APC Number 34-7-21
One Letter Code VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH₂
Synonyms Ucn II (mouse)
Molecular Formula C₁₈₇H₃₂₀N₅₆O₅₀
Relative Molecular Mass 4152.95
CAS Registry Number [330648-32-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C