Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

LL-37 amide trifluoroacetate salt
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH₂ trifluoroacetate salt

H-6224

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6224.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 400.00
CHF 372.00 (7%)
H-6224.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'200.00
CHF 1'116.00 (7%)
Add to Wish List
Add to Compare

Details

LL-37 amide is an antimicrobial peptide with angiogenic activity.
Item Number 4046855
One Letter Code LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂
Synonyms Antibacterial Protein LL-37 amide (human), LL37, CAMP
Molecular Formula C₂₀₅H₃₄₁N₆₁O₅₂
Relative Molecular Mass 4492.34
CAS Registry Number [597562-32-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C