Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

H-6220

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6220.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-6220.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare
Item Number 4012268
APC Number 46-4-30
One Letter Code YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Synonyms GIP (porcine), Glucose-Dependent Insulinotropic Polypeptide (porcine), Gastric Inhibitory Peptide, porcine
Molecular Formula C₂₂₅H₃₄₂N₆₀O₆₆S
Relative Molecular Mass 4975.62
CAS Registry Number [11063-17-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes