Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β/A4 Protein Precursor₇₇₀ (740-770) trifluoroacetate salt
H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH trifluoroacetate salt

H-6216

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6216.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 181.00
CHF 168.33 (7%)
H-6216.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 721.00
CHF 670.53 (7%)
Add to Wish List
Add to Compare

Details

Amyloid β/A4 Protein Precursor₇₇₀ (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.
Item Number 4048249
APC Number 62-0-15
One Letter Code AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Synonyms C31, APP₇₇₀ (740-770), Amyloid Precursor C-Terminal Peptide
Molecular Formula C₁₆₂H₂₄₃N₄₅O₅₂S₂
Relative Molecular Mass 3717.12
CAS Registry Number [1802086-24-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease