Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
H-Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH₂ trifluoroacetate salt

H-6165

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6165.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 678.00
CHF 630.54 (7%)
Add to Wish List
Add to Compare

Details

Pancreastatin strongly inhibits glucose-induced and gastric inhibitory peptide-induced insulin secretion from rat pancreas. It shows a high sequence homology to the central part of bovine, human, and rat chromogranin A.
Item Number 4030913
APC Number 46-4-60
One Letter Code GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH₂
Synonyms Chromogranin A (240-288) (porcine), Chromogranin A (240-288) (dephosphorylated) (porcine)
Molecular Formula C₂₁₄H₃₃₀N₆₈O₇₆S
Relative Molecular Mass 5103.45
CAS Registry Number [106477-83-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes