Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin-Like Peptide (human) trifluoroacetate salt
H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser-OH trifluoroacetate salt

H-6078

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6078.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 824.00
CHF 766.32 (7%)
H-6078.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'339.00
CHF 1'245.27 (7%)
Add to Wish List
Add to Compare

Details

Galanin-like peptide (GALP) is a 60 amino acid neuropeptide first isolated from the porcine hypothalamus and subsequently also identified in rats and humans. GALP exhibits a higher affinity (~18-fold) for the GALR2 receptor compared to the GALR1 receptor, whereas galanin is relatively non-selective. Investigations of the physiological role of GALP revealed that GALP induces food intake with a ten times higher orexigenic activity than galanin. Furthermore, GALP could affect the emotional state in the CNS. Therefore, GALP represents an orexigenic and anxiogenic peptide.
Item Number 4044537
One Letter Code APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Synonyms GALP (human)
Molecular Formula C₂₉₂H₄₅₁N₈₃O₈₄S
Relative Molecular Mass 6500.37
CAS Registry Number [245114-99-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Obesity Research