Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GRPP (human) trifluoroacetate salt
H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH trifluoroacetate salt

H-6062

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6062.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-6062.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 515.00
CHF 478.95 (7%)
Add to Wish List
Add to Compare

Details

GRPP (human) also known as glicentin-related polypeptide (human) is a synthetic analog of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells.
Item Number 4044528
One Letter Code RSLQDTEEKSRSFSASQADPLSDPDQMNED
Synonyms Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human)
Molecular Formula C₁₃₆H₂₁₅N₄₁O₅₈S
Relative Molecular Mass 3384.51
CAS Registry Number [1132745-52-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes