Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Oxyntomodulin (human, mouse, rat) trifluoroacetate salt
H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH trifluoroacetate salt

H-6058

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6058.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 618.00
CHF 574.74 (7%)
H-6058.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'133.00
CHF 1'053.69 (7%)
Add to Wish List
Add to Compare

Details

Oxyntomodulin potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.
Item Number 4044527
APC Number 46-1-46
One Letter Code HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Synonyms Glucagon-37 (human, mouse, rat), OXM (human, mouse, rat), Preproglucagon (53-89) (human, mouse, rat), Proglucagon (33-69) (human, mouse, rat)
Molecular Formula C₁₉₂H₂₉₅N₆₁O₆₀S
Relative Molecular Mass 4449.90
CAS Registry Number [159002-68-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes
Veterinary Medicine