Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Peptide YY (3-36) (canine, mouse, porcine, rat) trifluoroacetate salt
H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

H-6042

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6042.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-6042.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 361.00
CHF 335.73 (7%)
Add to Wish List
Add to Compare

Details

Peptide YY (3-36) and peptide YY are both synthesized by the gastrointestinal tract and released into the circulation after a meal. Peptide YY (3-36) is a Y₂ receptor subtype agonist, whereas peptide YY is non-selective for Y₁ and Y₂ receptor subtypes. It has been suggested that Y₁ and Y₂ receptor subtype binding affinities depend on their secondary and tertiary solution state structures.
Item Number 4044052
One Letter Code AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (3-36) (canine, mouse, porcine, rat)
Molecular Formula C₁₇₆H₂₇₂N₅₂O₅₄
Relative Molecular Mass 3980.41
CAS Registry Number [126339-09-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research