Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ trifluoroacetate salt

H-6025

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6025.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
H-6025.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)
Add to Wish List
Add to Compare
Item Number 4030651
APC Number 46-1-12
One Letter Code HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Synonyms Glucagon-Like Peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat), Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat), Proglucagon (72-107) amide (human, bovine, guinea pig, mouse, rat)
Molecular Formula C₁₈₄H₂₇₃N₅₁O₅₇
Relative Molecular Mass 4111.50
CAS Registry Number [99658-04-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Areas of Interest Diabetes