Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

BNP-32 (rat) trifluoroacetate salt
H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH trifluoroacetate salt
(Disulfide bond)

H-5968

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5968.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 484.00
CHF 450.12 (7%)
H-5968.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 865.00
CHF 804.45 (7%)
Add to Wish List
Add to Compare
Item Number 4043015
APC Number 14-5-11
One Letter Code NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Synonyms Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat
Molecular Formula C₁₄₆H₂₃₉N₄₇O₄₄S₃
Relative Molecular Mass 3452.99
CAS Registry Number [133448-20-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Regenerative Medicine