Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-42) (mouse, rat)
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

H-5966

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5966.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 289.00
CHF 268.77 (7%)
H-5966.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

Rodent Aβ 1-42 is considerably less aggregation-prone than human Aβ 1-42, but antimicrobial activity against a range of clinically relevant microorganisms has been shown for both peptides.
Item Number 4035885
APC Number 62-0-84
One Letter Code DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms β-Amyloid Peptide (1-42), mouse, rat
Molecular Formula C₁₉₉H₃₀₇N₅₃O₅₉S
Relative Molecular Mass 4418.01
CAS Registry Number [166090-74-0]
Source Synthetic
Storage Conditions -20 ± 5 °C