Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt
H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-OH trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)

H-5818

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5818.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'298.00
CHF 1'207.14 (7%)
H-5818.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 2'338.00
CHF 2'174.34 (7%)
Add to Wish List
Add to Compare

Details

Big ET-1 (1-31) exhibited chemotactic activities towards human neutrophils and monocytes which could be inhibited by the ET-A receptor antagonist BQ-123 (H-1252) but not by the ET-B receptor antagonist BQ-788 (H-2492).
Item Number 4038346
One Letter Code CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY
Synonyms Big ET-1 (1-31) (human, bovine)
Molecular Formula C₁₆₂H₂₃₆N₃₈O₄₇S₅
Relative Molecular Mass 3628.21
CAS Registry Number [133972-52-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Chemotactic peptide