Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Tyr⁰)-BNP-32 (human) trifluoroacetate salt
H-Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH trifluoroacetate salt
(Disulfide bond)

H-5698

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5698.0500 0.5 mg Ships within 3-5 business days  
CHF 464.00
CHF 431.52 (7%)
H-5698.1000 1 mg Ships within 3-5 business days  
CHF 824.00
CHF 766.32 (7%)
Add to Wish List
Add to Compare
Item Number 4039298
APC Number 14-1-91
One Letter Code YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms (Tyr⁰)-Brain Natriuretic Peptide-32 (human), [Tyr0] BNP (1-32) human
Molecular Formula C₁₅₂H₂₅₃N₅₁O₄₄S₄
Relative Molecular Mass 3627.26
CAS Registry Number [1815617-97-0] net
Source Synthetic
Storage Conditions -20 ± 5 °C