Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Helodermin
H-His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH₂

H-5696

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5696.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-5696.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'648.00
CHF 1'532.64 (7%)
Add to Wish List
Add to Compare

Details

Helodermin (exendin-2) was originally isolated from the venom of Gila monster (Heloderma suspectum). A high degree of sequence similarities to secretin, VIP, PHI, and GRF from mammal and bird was observed over the entire N-terminal (1-27) sequence. The isolation of helodermin was the first demonstration of the existence of a secretin/VIP-related peptide in an animal that is neither mammal nor bird. Among all known VIP-related peptides, helodermin was the most potent in stimulating cAMP production by NCI-H345 cell line.
Item Number 4039850
APC Number 73-0-15
One Letter Code HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH₂
Molecular Formula C₁₇₆H₂₈₅N₄₇O₄₉
Relative Molecular Mass 3843.49
CAS Registry Number [89468-62-2]
Source Synthetic
Storage Conditions -20 ± 5 °C