Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-2 (1-33) (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH trifluoroacetate salt

H-5662

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5662.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-5662.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 371.00
CHF 345.03 (7%)
Add to Wish List
Add to Compare

Details

Like GLP-1, GLP-2 is secreted from enteroendocrine cells in a nutrient-dependent manner in both rodents and humans. Currently GLP-2 is used as a potential therapeutic agent for human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
Item Number 4039611
One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Synonyms Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human)
Molecular Formula C₁₆₅H₂₅₄N₄₄O₅₅S
Relative Molecular Mass 3766.16
CAS Registry Number [223460-79-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes