Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Gastric Inhibitory Polypeptide (human)
H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

H-5645

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5645.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
H-5645.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)
Add to Wish List
Add to Compare

Details

Gastric inhibitory polypeptide (GIP), an incretin, represents an essential regulator of insulin secretion and glucose homeostasis.
Item Number 4030658
APC Number 46-1-60
One Letter Code YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms GIP (human), Glucose-Dependent Insulinotropic Polypeptide (human), GIP (1-42) (human)
Molecular Formula C₂₂₆H₃₃₈N₆₀O₆₆S
Relative Molecular Mass 4983.60
CAS Registry Number [100040-31-1]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes