Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) (mouse, rat)
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

H-5638

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5638.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 217.00
CHF 201.81 (7%)
H-5638.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 360.00
CHF 334.80 (7%)
Add to Wish List
Add to Compare
Item Number 4035886
APC Number 62-0-86
One Letter Code DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms β-Amyloid (1-40), rat
Molecular Formula C₁₉₀H₂₉₁N₅₁O₅₇S
Relative Molecular Mass 4233.78
CAS Registry Number [144409-98-3]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease