Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

β-Endorphin (equine)
H-Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln-OH

H-5636

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5636.0001 1 mg Ships within 3-5 business days  
CHF 453.00
CHF 421.29 (7%)
H-5636.0005 5 mg Ships within 1 business day  
CHF 1'813.00
CHF 1'686.09 (7%)
Add to Wish List
Add to Compare

Details

β-Endorphin (equine) exhibited three times higher receptor binding activity in rat membrane preparations and a 1.6 times more potent analgesic effect in the mouse tail-flick assay than the human hormone.
Item Number 4037717
One Letter Code YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Molecular Formula C₁₅₄H₂₄₈N₄₂O₄₄S
Relative Molecular Mass 3423.99
CAS Registry Number [79495-86-6]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Opioid Research