Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Urocortin III (human) trifluoroacetate salt
H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH₂ trifluoroacetate salt

H-5634

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5634.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-5634.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 721.00
CHF 670.53 (7%)
Add to Wish List
Add to Compare

Details

Urocortin III (human) is a highly selective ligand for the CRF-II receptor. The amino acid sequence of UCN III corresponds to amino acids 3-40 of stresscopin (human) (H-5546).
Item Number 4039202
APC Number 34-7-20
One Letter Code FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH₂
Synonyms Stresscopin (3-40) (human)
Molecular Formula C₁₈₅H₃₀₇N₅₃O₅₀S₂
Relative Molecular Mass 4137.93
CAS Registry Number [357952-09-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C