Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Neuropeptide VF (56-92) (human) trifluoroacetate salt
H-Ser-Leu-Asn-Phe-Glu-Glu-Leu-Lys-Asp-Trp-Gly-Pro-Lys-Asn-Val-Ile-Lys-Met-Ser-Thr-Pro-Ala-Val-Asn-Lys-Met-Pro-His-Ser-Phe-Ala-Asn-Leu-Pro-Leu-Arg-Phe-NH₂ trifluoroacetate salt

H-5606

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5606.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-5606.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 742.00
CHF 690.06 (7%)
Add to Wish List
Add to Compare

Details

Neuropeptide NPSF is, as the octapeptide NPVF H-5608, a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.
Item Number 4038664
One Letter Code SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH₂
Synonyms S-37-F-NH₂, NPSF
Molecular Formula C₁₉₅H₃₀₄N₅₂O₅₁S₂
Relative Molecular Mass 4257.01
CAS Registry Number [381006-66-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C