Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) hydrochloride salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH hydrochloride salt

H-5568

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5568.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 100.00
CHF 93.00 (7%)
H-5568.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 217.00
CHF 201.81 (7%)
H-5568.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 361.00
CHF 335.73 (7%)
Add to Wish List
Add to Compare

Details

Compared to the TFA salt, the HCl salt of amyloid β-protein (1-40) easily forms β-structures in PBS within a few hours at 25°C. β-structure formation is essential for amyloid peptide toxicity.
Item Number 4038267
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 hydrochloride salt
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [131438-79-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease

Product citations

I.Kaneko, J. Neurochem., 68, 438 (1997)