Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH trifluoroacetate salt

H-5552

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5552.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-5552.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 494.00
CHF 459.42 (7%)
Add to Wish List
Add to Compare

Details

Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus.
In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity.
Item Number 4037542
APC Number 46-1-11
One Letter Code HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Synonyms Glucagon-Like Peptide 1 (1-37) (human, bovine, guinea pig, mouse, rat), Proglucagon (72-108) (human, bovine, guinea pig, mouse, rat), Preproglucagon (92-128) (human, bovine, guinea pig, mouse, rat)
Molecular Formula C₁₈₆H₂₇₅N₅₁O₅₉
Relative Molecular Mass 4169.54
CAS Registry Number [87805-34-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Insulinotropic hormone; Incretin
Areas of Interest Diabetes