Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Kisspeptin-54 (27-54) (human) trifluoroacetate salt
H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ trifluoroacetate salt

H-5542

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5542.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 600.00
CHF 558.00 (7%)
H-5542.0005 5 mg Ships within 3-5 business days  
CHF 2'400.00
CHF 2'232.00 (7%)
Add to Wish List
Add to Compare

Details

An LRF-amide motif containing fragment of malignant melanoma metastasis-suppressor KiSS-1 which binds to human GPR54, a G-protein-coupled receptor also known as AXOR12. It shows lower agonistic potency towards AXOR12 than malignant melanoma metastasis-suppressor Kisspeptin-10 (H-5544).
Item Number 4037533
One Letter Code IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂
Synonyms Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human), KiSS-1 (94-121) (human), Metastin (27-54) (human)
Molecular Formula C₁₄₉H₂₂₆N₄₂O₃₉
Relative Molecular Mass 3229.69
CAS Registry Number [1135442-77-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cancer Research