Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Urotensin I
H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH₂

H-5500

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5500.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-5500.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare

Details

Urotensin I was found to be a close structural and biological homolog of the ovine hypothalamic corticotropin-releasing factor (CRF) and the frog skin peptide sauvagine.
Item Number 4011660
APC Number 80-7-15
One Letter Code NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH₂
Molecular Formula C₂₁₀H₃₄₀N₆₂O₆₇S₂
Relative Molecular Mass 4869.52
CAS Registry Number [83930-33-0]
Source Synthetic
Storage Conditions -20 ± 5 °C