Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Prepro-Atrial Natriuretic Factor (26-55) (human)
H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH

H-5472

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-5472.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 505.00
CHF 469.65 (7%)
Add to Wish List
Add to Compare

Details

Prepro-atrial natriuretic factor (26-55) (human) (NT-pro-ANP (1-30)) is one of four peptide hormones derived from the atrial natriuretic prohormone. It is also known as long acting natriuretic peptide. The peptide has potent vasodilatory properties equal to atrial natriuretic factor. Vasodilation is associated with a 4-5 fold increase in cyclic GMP levels due to activation of particulate guanylate cyclase activity. Like prepro-atrial natriuretic factor (56-92) and kaliuretic peptide it is present in higher concentration in individuals with congestive heart failure. It causes the maximal increase in prostaglandin E2 (PGE2) levels of the three peptides. The known increase in PGE2 in chronic heart failure may be in part secondary to these peptides.
Item Number 4037110
APC Number 14-1-32
One Letter Code NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Synonyms Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human), NT-pro-ANP (human) (1-30), Prepro-ANF (26-55), human
Molecular Formula C₁₅₂H₂₃₆N₃₈O₅₁S₃
Relative Molecular Mass 3507.97
CAS Registry Number [112160-82-4]
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone stimulating vasodilation