Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

ACTH (1-39) (mouse, rat) trifluoroacetate salt
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

H-4998

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4998.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 185.00
CHF 172.05 (7%)
H-4998.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
Add to Wish List
Add to Compare
Item Number 4034845
APC Number 10-1-15
One Letter Code SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Molecular Formula C₂₁₀H₃₁₅N₅₇O₅₇S
Relative Molecular Mass 4582.23
CAS Registry Number [77465-10-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Peptide hormone