Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Adrenomedullin (13-52) (human)
H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂
(Disulfide bond)

H-4936

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4936.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 412.00
CHF 383.16 (7%)
H-4936.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 721.00
CHF 670.53 (7%)
Add to Wish List
Add to Compare

Details

This adrenomedullin fragment possessed vasodilatory activity. It has been suggested to modulate receptor-mediated, but not voltage-dependent, pulmonary vascular contraction by influencing Ca²⁺ influx. Therefore, it has been proposed that hADM (13-52) acts as an endothelium-dependent vasodilator agent in the pulmonary vascular bed of the rat. Furthermore, this compound may act as a modulator of the vascular phases of inflammation.
Item Number 4034489
APC Number 22-1-11
One Letter Code SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂
Molecular Formula C₂₀₀H₃₀₈N₅₈O₅₉S₂
Relative Molecular Mass 4533.13
CAS Registry Number [154765-05-6]
Source Synthetic
Storage Conditions -20 ± 5 °C