Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Dendroaspis Natriuretic Peptide
H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH
(Disulfide bond)

H-4904

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4904.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 361.00
CHF 335.73 (7%)
H-4904.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 670.00
CHF 623.10 (7%)
Add to Wish List
Add to Compare

Details

The 38 amino acid peptide DNP, which has been originally isolated from the venom of the green mamba snake (Dendroaspis angusticeps), shares structural homology with the family of natriuretic peptides. DNP contains a 17 amino acid disulfide ring similar to ANP, BNP, and CNP, which mediate biological actions through particulate guanylyl cyclase receptors and generation of guanosine monophosphate (cGMP).
Item Number 4033517
One Letter Code EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
Synonyms DNP
Molecular Formula C₁₈₀H₂₈₂N₅₆O₅₆S₂
Relative Molecular Mass 4190.69
CAS Registry Number [255721-52-9]
Source Synthetic
Storage Conditions -20 ± 5 °C