Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

TIP-39 trifluoroacetate salt
H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH trifluoroacetate salt

H-4878

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4878.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
H-4878.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 578.00
CHF 537.54 (7%)
Add to Wish List
Add to Compare

Details

Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective agonist of the pTH2 receptor which regulates pituitary hormone secretion and spinal cord regions involved in pain perception. Synthetic TIP-39 activated the human and rat pTH2 receptors with EC₅₀ of 0.5 ± 0.12 nM and 0.8 ± 0.3 nM, respectively. TIP-39 was much more potent than pTH (EC₅₀ = 49 ± 23 nM) at the rat pTH2 receptor. The discovery of TIP-39 provides an important tool for the investigation of the pTH2 receptor functions inside and outside the nervous system.
Item Number 4033516
APC Number 22-1-31
One Letter Code SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula C₂₀₂H₃₂₅N₆₁O₅₄S
Relative Molecular Mass 4504.25
CAS Registry Number [277302-47-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C