Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH (1-34) (human) acetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt

H-4835

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4835.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-4835.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 824.00
CHF 766.32 (7%)
Add to Wish List
Add to Compare

Details

Teriparatide, which consists of the N-terminal 34 amino acid residues of parathyroid hormone, shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD).
Item Number 4011474
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Teriparatide, Parathyroid Hormone (1-34), human
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number [52232-67-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C

Bachem product citations

S.M.Condon et al., J. Am. Chem. Soc., 122, 3007 (2000)