Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

GLP-2 (1-34) (human) trifluoroacetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH trifluoroacetate salt

H-4766

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4766.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 206.00
CHF 191.58 (7%)
H-4766.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 371.00
CHF 345.03 (7%)
Add to Wish List
Add to Compare
Item Number 4029353
APC Number 46-1-14
One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Synonyms Glucagon-Like Peptide 2-Arg (human), Preproglucagon (146-179) (human), Proglucagon (126-159) (human), Glucagon-Like Peptide II, human
Molecular Formula C₁₇₁H₂₆₆N₄₈O₅₆S
Relative Molecular Mass 3922.35
CAS Registry Number [99120-49-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes