Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Peptide YY (canine, mouse, porcine, rat) trifluoroacetate salt
H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

H-4505

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4505.0500 0.5 mg Ships within 3-5 business days  
CHF 309.00
CHF 287.37 (7%)
H-4505.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare
Item Number 4031137
APC Number 48-0-40
One Letter Code YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH₂
Synonyms PYY (canine, mouse, porcine, rat)
Molecular Formula C₁₉₀H₂₈₈N₅₄O₅₇
Relative Molecular Mass 4240.71
CAS Registry Number [81858-94-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Gastrointestinal Research