Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Prolactin-Releasing Peptide (1-31) (rat)
H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH₂

H-4384

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4384.0500 0.5 mg Ships within 3-5 business days  
CHF 309.00
CHF 287.37 (7%)
H-4384.1000 1 mg Ships within 3-5 business days  
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare
Item Number 4028741
APC Number 52-6-12
One Letter Code SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH₂
Synonyms PrRP31 (rat), Preprolactin (23-53) (rat)
Molecular Formula C₁₅₆H₂₄₂N₅₄O₄₃S
Relative Molecular Mass 3594.04
CAS Registry Number [215510-06-8]
Source Synthetic
Storage Conditions -20 ± 5 °C