Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Prolactin-Releasing Peptide (1-31) (human)
H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH₂

H-4382

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-4382.0500 0.5 mg Ships within 3-5 business days  
CHF 309.00
CHF 287.37 (7%)
H-4382.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 567.00
CHF 527.31 (7%)
Add to Wish List
Add to Compare
Item Number 4028740
APC Number 52-6-11
One Letter Code SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH₂
Synonyms PrRP31 (human), Preprolactin (23-53) (human)
Molecular Formula C₁₆₀H₂₅₂N₅₆O₄₂S
Relative Molecular Mass 3664.18
CAS Registry Number [215510-22-8]
Source Synthetic
Storage Conditions -20 ± 5 °C